PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.K49J7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 223aa    MW: 24348.4 Da    PI: 9.8252
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.K49J7genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.2e-15111156247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++W++eE+ +++++ ++lG+g+W+ I+r++  +Rt+ q+ s+ qky
      Aradu.K49J7 111 LAWSEEEHRIFLEGMEKLGKGNWRGISRCFVRTRTPTQVASHAQKY 156
                      68*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6971227IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.765105161IPR017930Myb domain
TIGRFAMsTIGR015571.4E-16108160IPR006447Myb domain, plants
SuperFamilySSF466891.87E-16108162IPR009057Homeodomain-like
SMARTSM007171.6E-10109159IPR001005SANT/Myb domain
PfamPF002493.5E-12112156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-11112155IPR009057Homeodomain-like
CDDcd001671.39E-10112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MCGRIIIIIM ARKCTYCGNS GHNSRTCNHS FSSTTGGCSG LKLFGVQLDD NQYYSSSSCM  60
DYLLSLSAAA SLSSSLVGAN KNSHEISYSY LTSGASSSGL MSTIKDNNKG LAWSEEEHRI  120
FLEGMEKLGK GNWRGISRCF VRTRTPTQVA SHAQKYFLRQ TRRRNTFRSR KHRLTLANEG  180
TRNSDAVVLS HWLASATSTN CTSIQGAAAP DLELKLATPS PSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015935116.11e-157PREDICTED: transcription factor MYB1R1-like
TrEMBLA0A0B2RK504e-57A0A0B2RK50_GLYSO; Transcription factor MYB1R1
TrEMBLK7KT796e-57K7KT79_SOYBN; Uncharacterized protein
STRINGGLYMA06G05450.22e-56(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF151421013
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.12e-31MYB_related family protein